PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G39410.1
Common NameATWRKY13, F23K16.40, WRKY13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 304aa    MW: 34203.6 Da    PI: 7.5969
Description WRKY DNA-binding protein 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G39410.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32222280159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver a+dp++v++tYeg+H h+
  AT4G39410.1 222 LDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLADDPRMVITTYEGRHLHS 280
                  59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-33207280IPR003657WRKY domain
SuperFamilySSF1182902.88E-28215281IPR003657WRKY domain
PROSITE profilePS5081129.344217282IPR003657WRKY domain
SMARTSM007749.9E-37222281IPR003657WRKY domain
PfamPF031064.1E-25223279IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGAINQGISL FDESQTVINP INTNHLGFFF SFPSHSTLSS SSSSSSSSPS SLVSPFLGHN  60
SLNSFLHNNP SSFISHPQDS INLMTNLPET LISSLSSSKQ RDDHDGFLNL DHHRLTGSIS  120
SQRPLSNPWA WSCQAGYGSS QKNNHGSEID VDDNDDEVGD GGGINDDDNG RHHHHDTPSR  180
HDKHNTASLG VVSSLKMKKL KTRRKVREPR FCFKTLSEVD VLDDGYRWRK YGQKVVKNTQ  240
HPRSYYRCTQ DKCRVKKRVE RLADDPRMVI TTYEGRHLHS PSNHLDDDSL STSHLHPPLS  300
NFFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25214279974Probable WRKY transcription factor 4
2lex_A2e-25214279974Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306923490.0
Genevisible252891_at0.0
Expression AtlasAT4G39410-
AtGenExpressAT4G39410-
ATTED-IIAT4G39410-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WRKY13 acts in stem development. Mutants take on a weaker stem phenotype. The number of sclerenchyma cells, stem diameter and the number of vascular bundles were reduced in wrky13 mutants. Lignin-synthesis-related genes were repressed in wrky13 mutants.
    [PMID: 26025534]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G39410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G39410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4211530.0AF421153.1 Arabidopsis thaliana WRKY transcription factor 13 (WRKY13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195651.10.0putative WRKY transcription factor 13
SwissprotQ9SVB70.0WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLC0SVM60.0C0SVM6_ARATH; Putative uncharacterized protein At4g39410 (Fragment)
STRINGAT4G39410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Hass C, et al.
    The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.
    EMBO J., 2004. 23(16): p. 3290-302
    [PMID:15282545]
  6. Miao Y,Laun T,Zimmermann P,Zentgraf U
    Targets of the WRKY53 transcription factor and its role during leaf senescence in Arabidopsis.
    Plant Mol. Biol., 2004. 55(6): p. 853-67
    [PMID:15604721]
  7. Zhao Z,Zhu Y,Erhardt M,Ruan Y,Shen WH
    A non-canonical transferred DNA insertion at the BRI1 locus in Arabidopsis thaliana.
    J Integr Plant Biol, 2009. 51(4): p. 367-73
    [PMID:19341406]
  8. Li W,Tian Z,Yu D
    WRKY13 acts in stem development in Arabidopsis thaliana.
    Plant Sci., 2015. 236: p. 205-13
    [PMID:26025534]